Electronic Journal of Biotechnology ISSN: 0717-3458
  © 1999 by Universidad Católica de Valparaíso -- Chile
Vol. 2 No. 3, Issue of December 15, 1999
 

Region A

a
Pear
Bean
PYLETLEFHKQPNLTGPIQPAIAKLKGLKSLRLSWTNLSG
***  *      ** **** *****  *  *    ** **
PYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSG  40
   
 
 
Pear
Bean
SVPDFLSQLKNLTFLDLSFNNLTGAIPSSLSELPNLGALR
      ** * *  ** * * * *  * * * *****   
AIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLGGIT  80
     
 
Pear
Bean
LDRNKLTGHIPISFGQFIGNVPDLYLSHNQLSGNIPTSFA
 * *   * ** * * *         * * * * **  **
FDGNRISGAIPDSYGSFSKLFTAMTISRNRLTGKIPPTFA  120
     
 
Pear
Bean
QMDFTSIDLSRNKLEGDASVIFGLNKTTQIV
       ***** ******* **  *  
NLNLAFVDLSRNMLEGDASVLFGSDKNTKKI           151

 

Region B

b
IPGIPL
5'-C-GAATTC-CC GCC ATC GCT AAA CT -3'

             A   T   T   C   G
 
AA (REGION A)
           P    A   I   A   K   L      
 
IPGIPR
5'-CA-GGATCC-CTC CAG CAT GTT CCG A -3'

             T   G    T      A   T
 
AA (REGION B)
          G   E   L   M/K N   R  

 

Figure 1. (a) Amino acid sequence alignment of the central protein regions from bean and pear PGIPs (Toubart, et al., 1992; Stotz et al, 1993). Amino acid identities are indicated with an asterisk. The conserved regions A and B, which were used to design degenerate primers, are indicated in bold. (b) Degenerate primers, IPGIPL and IPGIPR and their corresponding amino acid (AA) sequences.

Supported by UNESCO / MIRCEN network